DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2915 and CG32379

DIOPT Version :9

Sequence 1:NP_610338.1 Gene:CG2915 / 35754 FlyBaseID:FBgn0033241 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster


Alignment Length:358 Identity:111/358 - (31%)
Similarity:174/358 - (48%) Gaps:43/358 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 LKTYKVKHRVLTYNFQEKIDRNLAEVQPESIDASQLDWQH------FFHLKTIYEWLDKMVEKYP 171
            ::.|.::::||..:....:....||...:.:   .:.|.|      |:....|.::||.::|::|
  Fly     1 MRNYHLEYKVLIEDLAPLVHAQRAENLRKKL---LIQWPHIDVLSAFYTHSEINDYLDSLLERFP 62

  Fly   172 NRVTVLDMGSSTQGNAIKGVKLTS---NANNKAIFIESGIHAREWISPAAATYIINQLLTSQDPK 233
            .||.|...|.|.:...:|.:.:|:   ..|...|.|:..:||||||||:.|.|||.|||.:....
  Fly    63 KRVQVKQFGWSYERRPLKVLTITNGDGRRNKPVILIDGTVHAREWISPSMALYIIQQLLDNYGDN 127

  Fly   234 VQQLAQDYNWIIFPCVNPDGYKYTFEHDRMWRKNRQLFGT--CRGVDLNRNYPDHW-NSTGSSSD 295
             |:|.|||:|:|.|.||.|||:||....|.|||:|:....  |.|.|:|||:...| :..|||||
  Fly   128 -QELLQDYDWVIMPVVNADGYEYTHTDSRYWRKSRRPTSNPECIGTDINRNFGYEWGHDEGSSSD 191

  Fly   296 PTRYDFAGPSAGSELETKRLIDFIRANAGKEQIKTYIALHSYSQMLMFPYGYTKERVSNYDDLQE 360
            |....:.|.....:.|::.|.|.:....|:  :..|::||||....:.|:|||.:....|.|:..
  Fly   192 PCENIYRGERPFDQSESQVLRDVMLHYKGR--LNFYLSLHSYGNYFLLPWGYTSDFPDTYQDMMS 254

  Fly   361 FGKKASAAIKAENGRDYVSGSLFETIYPSSGGSMDWAHSEAGIPIAYTFELRGPPDSQDLFILPA 425
            .....:.||.......|..||.:..:||:||.:.|:|.......:|.|.|            |||
  Fly   255 VADAGAKAIIYSTNGIYSYGSTYYVLYPTSGDTTDFAFGVVNATVAMTME------------LPA 307

  Fly   426 V----------EIQPTASEAFTAIRAIVEAAAE 448
            .          :|:...:|::..:||:   |||
  Fly   308 AGFQGFDPWISQIERLVTESWVGVRAM---AAE 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2915NP_610338.1 MpaA 50..433 CDD:225421 105/341 (31%)
Propep_M14 63..133 CDD:280416 3/19 (16%)
M14_CP_A-B_like 153..446 CDD:199844 101/308 (33%)
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 104/312 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466978
Domainoid 1 1.000 158 1.000 Domainoid score I1007
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - otm46992
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.