DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2915 and Nna1

DIOPT Version :9

Sequence 1:NP_610338.1 Gene:CG2915 / 35754 FlyBaseID:FBgn0033241 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001285225.1 Gene:Nna1 / 32329 FlyBaseID:FBgn0265726 Length:1890 Species:Drosophila melanogaster


Alignment Length:257 Identity:52/257 - (20%)
Similarity:91/257 - (35%) Gaps:87/257 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 GNAIKGVKLTSNANN-------KAIFIESGIHARE----WISPAAATYIINQLLTSQDPKVQQLA 238
            ||.:..:.:|:.::|       |:|.:.:.:|..|    |:......:|     |......::|.
  Fly   795 GNNVYYLTVTAPSSNEENMRRKKSIVVSARVHPSETPASWMMKGLMDFI-----TGDTTVAKRLR 854

  Fly   239 QDYNWIIFPCVNPDGYKYTFEHDRMWRKNRQLFGTCR----GVDLNR--------NYPDHWNSTG 291
            ..:.:.:.|.:||||.               :.|..|    |.||||        .||..|    
  Fly   855 HKFIFKLVPMLNPDGV---------------IVGNTRNSLTGKDLNRQYRTVIRETYPSIW---- 900

  Fly   292 SSSDPTRYDFAGPSAGSELETKRLIDFIRANAGKEQIKTYIALHSYSQM-LMFPYGYTKERVSNY 355
                               .||.:|..:....|   :..|..:|::|:. .:|.||...:|    
  Fly   901 -------------------YTKAMIRRLIEECG---VAMYCDMHAHSRKHNIFIYGCENKR---- 939

  Fly   356 DDLQEFGKKASAAIKAENGRDYVSGSLFET----IYPSSGGS---MDWAHSEAGIPIAYTFE 410
            :..::..::....:..:|..|..|   ||:    |..|..|:   :.|.   .||..:||.|
  Fly   940 NPEKKLTEQVFPLMLHKNSADRFS---FESCKFKIQRSKEGTGRIVVWM---LGITNSYTIE 995

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2915NP_610338.1 MpaA 50..433 CDD:225421 52/257 (20%)
Propep_M14 63..133 CDD:280416
M14_CP_A-B_like 153..446 CDD:199844 52/257 (20%)
Nna1NP_001285225.1 MpaA 625..>886 CDD:225421 22/110 (20%)
M14_AGBL2-3_like 771..1031 CDD:133117 52/257 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.