DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2915 and CG31019

DIOPT Version :9

Sequence 1:NP_610338.1 Gene:CG2915 / 35754 FlyBaseID:FBgn0033241 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_733391.1 Gene:CG31019 / 318558 FlyBaseID:FBgn0051019 Length:659 Species:Drosophila melanogaster


Alignment Length:365 Identity:83/365 - (22%)
Similarity:124/365 - (33%) Gaps:92/365 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 KVKHRVLTYNFQEKIDRNL--AEVQPESIDASQLDWQH------FFHLKTIYEW---------LD 164
            |...|||.:.......|||  :.:.|....:|:..||.      ||:...:::.         .|
  Fly   100 KQDQRVLFHIVNISKSRNLFSSGLTPLVKSSSRPKWQRLSKRQVFFYRSAMHQGHYVLSFAFIFD 164

  Fly   165 KMVEKY-------------PNRVTVLD--MGSSTQGNAIKGVKLTSNANNKAIFIES-------- 206
            |..:.|             .:.:.|:|  .||..:......||...|.|...:.|:.        
  Fly   165 KEEDVYQFALAWPYSYSRLQSYLNVIDARQGSDKRFTRCVLVKSLQNRNVDLLTIDHVTAKQRST 229

  Fly   207 -----------GIHAREWISPAAATYI---INQLLTSQDPKVQQLAQDYNWIIFPCVNPDGYKYT 257
                       .:..|...|.|.|:::   :.:.|....|....|..::.:.|.|.|||||.   
  Fly   230 NRLDRSFIRVIVVLCRTHSSEAPASHVCQGLIEFLVGNHPIAAVLRDNFVFKIVPMVNPDGV--- 291

  Fly   258 FEHDRMWRKNRQLFGTCR--GVDLNRNYPDHWNSTGSSSDPTRY---------DFAGPSAGSELE 311
                 ....||     |.  |.|:|||    |:.....:.|..:         |.:..|.|.|.:
  Fly   292 -----FLGNNR-----CNLMGQDMNRN----WHIGSEFTQPELHAVKGMLKELDNSDVSRGIETD 342

  Fly   312 TKRLIDFIRANAGKE--QIKTYIALHSYSQML-MFPYGYTKERVSNYDDLQEFGKKASAAIKAEN 373
            ...:|.....|...:  ||...|.||:.|.|. .|.||.|.|.|..|:....|.:     :.|.|
  Fly   343 LIGIIFVCSYNISFQTYQIDFVIDLHANSSMHGCFIYGNTYEDVYRYERHLVFPR-----LFASN 402

  Fly   374 GRDYVSGSLFETIYPSSGGSMDWAHSE--AGIPIAYTFEL 411
            .:|||:............|||.....|  :....|||.|:
  Fly   403 AQDYVADHTMFNADERKAGSMRRFSCERLSDTVNAYTLEV 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2915NP_610338.1 MpaA 50..433 CDD:225421 83/365 (23%)
Propep_M14 63..133 CDD:280416 4/15 (27%)
M14_CP_A-B_like 153..446 CDD:199844 72/321 (22%)
CG31019NP_733391.1 M14_AGBL4_like 190..478 CDD:133118 66/275 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.