DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2915 and Agtpbp1

DIOPT Version :9

Sequence 1:NP_610338.1 Gene:CG2915 / 35754 FlyBaseID:FBgn0033241 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001099570.1 Gene:Agtpbp1 / 290986 RGDID:1306307 Length:1219 Species:Rattus norvegicus


Alignment Length:308 Identity:64/308 - (20%)
Similarity:107/308 - (34%) Gaps:74/308 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 VQPESIDASQLDWQHFFHLKTIYEWLDKMVEKY-PNRVTVLD--MGSSTQGNAIKGVKLTSNANN 199
            |.|...|.....:.:.:...|:...|.|:...: |.::....  :..:..||:...|.:|:...:
  Rat   827 VFPHKDDVCYFAYHYPYTYSTLQMHLQKLESAHNPQQIYFRKDVLCETLSGNSCPLVTITAMPES 891

  Fly   200 K------------AIFIESGIHARE----WISPAAATYIINQLLTSQDPKVQQLAQDYNWIIFPC 248
            .            .||:.:.:|..|    |:......|     |.|..|..|.|.:.|.:.|.|.
  Rat   892 SYYEHICQFRTRPYIFLSARVHPGETNASWVMKGTLEY-----LMSNSPTAQSLREAYIFKIVPM 951

  Fly   249 VNPDGYKYTFEHDRMWRKNRQLFGTCR----GVDLNRNYPDHWNSTGSSSDPTRYDFAGPSAGSE 309
            :||||.               :.|..|    |.||||    .|.|......||.|          
  Rat   952 LNPDGV---------------INGNHRCSLSGEDLNR----QWQSPNPELHPTIY---------- 987

  Fly   310 LETKRLIDFIRANAGKEQIKTYIALHSYSQML-MFPYG--------YTKERVSNYDDLQEFGKKA 365
             ..|.|:.::.  |.|.....|...|.:|:.. :|.||        :|.:..::.|.:::.|.:.
  Rat   988 -HAKGLLQYLA--AVKRLPLVYCDYHGHSRKKNVFMYGCSIKETVWHTHDNAASCDVVEDMGYRT 1049

  Fly   366 SAAIKAENGRDYVSGS---LFETIYPSSGGSMDWAHSEAGIPIAYTFE 410
            ...|.:.....:...|   :.|....|:...:.|  .|.|:..:||.|
  Rat  1050 LPKILSHIAPAFCMSSCSFVVEKSKESTARVVVW--REIGVQRSYTME 1095

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2915NP_610338.1 MpaA 50..433 CDD:225421 64/308 (21%)
Propep_M14 63..133 CDD:280416
M14_CP_A-B_like 153..446 CDD:199844 61/293 (21%)
Agtpbp1NP_001099570.1 Pepdidase_M14_N 705..839 CDD:407865 3/11 (27%)
M14_Nna1 862..1132 CDD:349477 57/273 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.