DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2915 and AGTPBP1

DIOPT Version :9

Sequence 1:NP_610338.1 Gene:CG2915 / 35754 FlyBaseID:FBgn0033241 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001273644.1 Gene:AGTPBP1 / 23287 HGNCID:17258 Length:1278 Species:Homo sapiens


Alignment Length:330 Identity:68/330 - (20%)
Similarity:111/330 - (33%) Gaps:102/330 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 TYNFQEKID-----------RNLAEVQPESIDASQLDWQHFFHLKTIYEWLDKMVEKYPNRVTVL 177
            |.||..|.|           .:..::..:.::::....|.:|....:.|.|              
Human   884 TVNFPHKDDVCYFAYHYPYTYSTLQMHLQKLESAHNPQQIYFRKDVLCETL-------------- 934

  Fly   178 DMGSSTQGNAIKGVKLT----SN--------ANNKAIFIESGIHARE----WISPAAATYIINQL 226
                  .||:...|.:|    ||        .|...:|:.:.:|..|    |:......|     
Human   935 ------SGNSCPLVTITAMPESNYYEHICHFRNRPYVFLSARVHPGETNASWVMKGTLEY----- 988

  Fly   227 LTSQDPKVQQLAQDYNWIIFPCVNPDGYKYTFEHDRMWRKNRQLFGTCR----GVDLNRNYPDHW 287
            |.|.:|..|.|.:.|.:.|.|.:||||.               :.|..|    |.||||    .|
Human   989 LMSNNPTAQSLRESYIFKIVPMLNPDGV---------------INGNHRCSLSGEDLNR----QW 1034

  Fly   288 NSTGSSSDPTRYDFAGPSAGSELETKRLIDFIRANAGKEQIKTYIALHSYSQML-MFPYG----- 346
            .|......||.|           ..|.|:.::.  |.|.....|...|.:|:.. :|.||     
Human  1035 QSPSPDLHPTIY-----------HAKGLLQYLA--AVKRLPLVYCDYHGHSRKKNVFMYGCSIKE 1086

  Fly   347 ---YTKERVSNYDDLQEFGKKASAAIKAENGRDYVSGS---LFETIYPSSGGSMDWAHSEAGIPI 405
               :|.:..::.|.:::.|.:....|.:.....:...|   :.|....|:...:.|  .|.|:..
Human  1087 TVWHTNDNATSCDVVEDTGYRTLPKILSHIAPAFCMSSCSFVVEKSKESTARVVVW--REIGVQR 1149

  Fly   406 AYTFE 410
            :||.|
Human  1150 SYTME 1154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2915NP_610338.1 MpaA 50..433 CDD:225421 68/330 (21%)
Propep_M14 63..133 CDD:280416 5/19 (26%)
M14_CP_A-B_like 153..446 CDD:199844 62/290 (21%)
AGTPBP1NP_001273644.1 M14_Nna1 911..1188 CDD:133116 63/303 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.