DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2915 and W01A8.6

DIOPT Version :9

Sequence 1:NP_610338.1 Gene:CG2915 / 35754 FlyBaseID:FBgn0033241 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_492003.2 Gene:W01A8.6 / 189076 WormBaseID:WBGene00012168 Length:380 Species:Caenorhabditis elegans


Alignment Length:335 Identity:93/335 - (27%)
Similarity:152/335 - (45%) Gaps:47/335 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 FFHLKTIYEWLDKMVEKY--------PNRVTVLDMGSSTQGNAIKGVKLTSNA----NNKAIFIE 205
            ||.|....:|  ...|.|        |:.|.:..:|.:.:|..:.||::...|    ...|::::
 Worm    29 FFDLTVYNDW--PQFEDYIKGVAHDNPSFVQLKTIGRTREGRPLLGVRIGKPALPGKRKIAVWLD 91

  Fly   206 SGIHAREWISPAAATYIINQLLTS--QDPKVQQLAQDYNWIIFPCVNPDGYKY----TFEHDRMW 264
            .|.|||||.:...|.|.|.:|:..  .|.|:.:..:..:..:||.:||||:.|    |....|.|
 Worm    92 GGNHAREWPAFHVAVYFIEKLVNGYLSDDKITKYVETLDIYVFPVLNPDGFVYSRTSTRAMIRQW 156

  Fly   265 RKNR---QLFGT--------CRGVDLNRNYP---DHWNSTGSSSDPTRYDFAGPSAGSELETKRL 315
            ||||   ...||        |.||||||||.   .|.|.  ..::|...:|.||...||.||:.:
 Worm   157 RKNRAPENCTGTGPFQTDICCEGVDLNRNYDIGFSHKNY--PFNNPCSDEFQGPRPFSEPETRAV 219

  Fly   316 IDFIRANAGKEQIKTYIALHSYSQMLMFPYGYTKERV-SNYDDLQEFGKKASAAIKAENGRDYVS 379
            .|||.::....::...:::|::.|:.:.||.|.|... .:..||:....:|:..:.|.....|..
 Worm   220 RDFIMSSEIYGRLYALVSMHTHGQLWILPYNYQKRTYPQDIKDLEILANRAADRVFAYRETKYRV 284

  Fly   380 GSLFETIYPSSGGSMDWAHSEAGIPIAYTFELRGPPDSQDLFILPAVEIQ-----PTASEAFTAI 439
            |:..:.:..::||:.||.  :...|..|.:.|..|||.:..|   |.:::     |...|.:..|
 Worm   285 GTAADMLGTATGGATDWI--KKNTPTKYVYVLELPPDMKTWF---AFQVKPHWLIPIGKETWLGI 344

  Fly   440 RAIVEAAAEK 449
            ..|.:...|:
 Worm   345 EVIFDQVVEE 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2915NP_610338.1 MpaA 50..433 CDD:225421 89/317 (28%)
Propep_M14 63..133 CDD:280416
M14_CP_A-B_like 153..446 CDD:199844 92/330 (28%)
W01A8.6NP_492003.2 Zn_pept 35..337 CDD:214748 86/310 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 220 1.000 Domainoid score I1500
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47975
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100142
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.