DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2915 and ccpp-6

DIOPT Version :9

Sequence 1:NP_610338.1 Gene:CG2915 / 35754 FlyBaseID:FBgn0033241 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_495012.2 Gene:ccpp-6 / 184043 WormBaseID:WBGene00017136 Length:459 Species:Caenorhabditis elegans


Alignment Length:306 Identity:67/306 - (21%)
Similarity:107/306 - (34%) Gaps:106/306 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 FFHLKTIYEWLDKMVEKYPNRVTVLDMGSSTQGNAIKGVKLTSNANNKAIFIESGIHAREWISPA 217
            |||...:.:.:.|      .||.::.:.::..         |...:.|.||:.:.:|..|  ||:
 Worm   163 FFHRDLLVQTVQK------RRVDLITIDATPD---------TFQGSKKMIFLTARVHPGE--SPS 210

  Fly   218 A-ATYIINQLLTSQDPKVQQLAQDYNWIIFPCVNPDG-----YKYT-FEHD--RMWRKNRQLFGT 273
            : ..:.|.:.|.|:|.:.|:|.:.|.:.|.|.:||||     |:.: ..||  ||||.       
 Worm   211 SHVMHGIIEFLVSKDDRAQKLRKVYCFKIIPMLNPDGVFLGNYRCSLMGHDLNRMWRT------- 268

  Fly   274 CRGVDLNRNYPDHWNSTGSSSDP---------TRYDFAGPSAGSELETKRLIDFIRANAGKEQIK 329
                      |..|      :.|         |:||                     |..:.|..
 Worm   269 ----------PSDW------AHPSIYAVKNLLTQYD---------------------NNPQAQTV 296

  Fly   330 TYIALHSYSQM-LMFPYGYTK----ERVSNYDDL--------------QEFGKKASAAIKAENGR 375
            .|:.||::||. ..|.||...    |..|.:..|              .||.:..:...||..||
 Worm   297 IYVDLHAHSQKPNCFLYGNVNMSAVEEKSTFRQLWLPHLLADLSEDYSLEFTQFNTDVEKAGTGR 361

  Fly   376 DYVSGSLFETIYPSSGGSMDWAHSEA---GIP-----IAYTFELRG 413
            ..:...|....|........:.|:::   ||.     :.|.:|..|
 Worm   362 RTMGDLLSCLCYTLEVSFFSYRHTDSSGNGIQHCTPYLQYKYEALG 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2915NP_610338.1 MpaA 50..433 CDD:225421 67/306 (22%)
Propep_M14 63..133 CDD:280416
M14_CP_A-B_like 153..446 CDD:199844 67/306 (22%)
ccpp-6NP_495012.2 M14_AGBL4_like 153..418 CDD:133118 67/306 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.