DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2915 and ZC434.9

DIOPT Version :9

Sequence 1:NP_610338.1 Gene:CG2915 / 35754 FlyBaseID:FBgn0033241 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001251356.1 Gene:ZC434.9 / 172908 WormBaseID:WBGene00013895 Length:720 Species:Caenorhabditis elegans


Alignment Length:475 Identity:144/475 - (30%)
Similarity:233/475 - (49%) Gaps:66/475 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TQWLVILCVAMAASGTNLDSGICPVAGDSGCRGNPPDQARYDNYRIYNVEFENQEQIELFQKLEE 79
            |.||:||..|.|.:        ..:|.|     .||      .:::......:..|::..:.:.|
 Worm     9 TLWLLILISAFAIN--------AEIADD-----KPP------KFQVLRAHATDVPQLKALRDIHE 54

  Fly    80 QSD-SLTFIGHAREVGQKLSILVAAHRVADIADLLKTYKVKHRVLTYNFQEKIDRNLAE------ 137
            ::. .|.|.....:||.:..|:|...|:..:..:||...:.:.|:.    |.:.:.:.|      
 Worm    55 RTQHDLDFWQTPSKVGHRADIMVDEDRMEWLDSVLKNSNISYDVII----EDVGKLILEKEHGPP 115

  Fly   138 ----------VQPESIDASQLDWQHFFHLKTIYEWLDKMVEKYPNRVTVLDMGSSTQGNAIKGVK 192
                      :..|..:.::..:..:...:||.:|:..:..|||::..|..||::::|..|:|:|
 Worm   116 RFSNLLFSKRMHNEGGNRARYGFGEYHSYQTICDWMKDIERKYPDKAKVFTMGTTSEGRPIQGIK 180

  Fly   193 LTSNA--NNKAIF-IESGIHAREWISPAAATYIINQLLT--SQDPKVQQLAQDYNWIIFPCVNPD 252
            :.|..  |:|.|| |:.|||||||.:...|.:.|::|:.  :.|..|:......|:.|.|..|||
 Worm   181 IGSQVWRNDKRIFWIDGGIHAREWAAVHTALWFIDRLIADYNDDSLVRAAVDRLNFYILPVANPD 245

  Fly   253 GYKYTFEHD-----RMWRKNRQLFGT------------CRGVDLNRNYPDHWNSTGSSSDPTRYD 300
            ||:|: ..|     |:|||||.  |.            |.||||||||..|:..||||:|.....
 Worm   246 GYEYS-RSDVSPMIRLWRKNRA--GVVCKKDRWFRDRCCGGVDLNRNYDWHFGETGSSTDKCSEI 307

  Fly   301 FAGPSAGSELETKRLIDFIRANAGKEQIKTYIALHSYSQMLMFPYGYTKERV-SNYDDLQEFGKK 364
            :.|.||.||.||:.:.||:.::....:|..:|.||:||||.:.||.:.::.| ::..:||..|:.
 Worm   308 YQGSSAFSESETRSMRDFLTSSELNGKIDAFITLHTYSQMWIHPYSHARKSVPADVAELQRVGRA 372

  Fly   365 ASAAIKAENGRDYVSGSLFETIYPSSGGSMDWAHSEAGIPIAYTFELRGPPDSQDLFILPAVEIQ 429
            |.||::...|..|..|:..:.:|||:|||.|||.....|...|..|||...|..|.|||...::.
 Worm   373 AVAALENTYGTKYKFGTGSDILYPSAGGSDDWAKGTLRIKYVYLLELRPGEDVWDGFILDQHQLI 437

  Fly   430 PTASEAFTAIRAIVEAAAEK 449
            |||.|.:..|:.::.|..|:
 Worm   438 PTAKETWNGIKVVIRAVTEQ 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2915NP_610338.1 MpaA 50..433 CDD:225421 129/422 (31%)
Propep_M14 63..133 CDD:280416 13/70 (19%)
M14_CP_A-B_like 153..446 CDD:199844 116/315 (37%)
ZC434.9NP_001251356.1 Propep_M14 45..111 CDD:366995 14/69 (20%)
M14_CP_A-B_like 141..454 CDD:349433 116/315 (37%)
ShK 682..719 CDD:366702
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 220 1.000 Domainoid score I1500
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - mtm4737
orthoMCL 1 0.900 - - OOG6_100142
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.