DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2915 and Y47G6A.19

DIOPT Version :9

Sequence 1:NP_610338.1 Gene:CG2915 / 35754 FlyBaseID:FBgn0033241 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001379340.1 Gene:Y47G6A.19 / 171921 WormBaseID:WBGene00021645 Length:509 Species:Caenorhabditis elegans


Alignment Length:455 Identity:132/455 - (29%)
Similarity:215/455 - (47%) Gaps:70/455 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VAGDSGCRGNPPDQARYDNYRIYNV-EFENQEQIELFQKLEEQSDSLTFIGHARE-VGQKLSILV 101
            :|..|.|:       .:..::::.| ...||:.:::.:..|..........||.. |...:.|:|
 Worm    11 IAVHSSCQ-------EHGAFKVFRVLPTTNQQLLQMIRLFETADTDRADFWHAPSVVNGTVDIMV 68

  Fly   102 AAHRVADIADLLKTYKVKHRVLTYNFQEKID---RNLAEVQ-----PESIDA------------- 145
            |...    .|..:.|..||   .|.||..||   :.|.|.:     ..:.||             
 Worm    69 APEH----TDQFRQYLEKH---GYTFQVAIDDLHKLLIEKEGNLSTHSNDDAFFLKRLHDDVGFH 126

  Fly   146 SQLDWQHFFHLKTIYEWLDKMVEKYPNRVTVLDMGSSTQGNAIKGVKLTSNA-NNKAIFIESGIH 209
            |:|....::....:..||:::.|..|:...::.:|::.:|..|.|:|...:. :.|.:.|::|||
 Worm   127 SRLRMGEYYSYSVLSTWLERIAENMPDIAKLIKVGTTIEGRDILGLKFGKDTPDKKIVVIDAGIH 191

  Fly   210 AREWISPAAATYIINQLLT--SQDPKVQQLAQDYNWIIFPCVNPDGYKY-----TFEHDRMWRKN 267
            ||||.:...|:|.||.::.  .:||::|....:....|.|.:|||||:|     |....|||||:
 Worm   192 AREWAAIHTASYFINLIVNGREEDPQIQNYLDNIVLYIIPVLNPDGYEYTRTDKTNPRARMWRKS 256

  Fly   268 RQ----LF-----GTCRGVDLNRNYPDHWNSTGSSSDPTRYDFAGPSAGSELETKRLIDFIRANA 323
            |.    .|     ..|.|||||||:...::..|:|..|....:.||||.||.|:|....|:.:..
 Worm   257 RSPKACAFDGVRNSCCMGVDLNRNFDFRFSEIGASRYPCSEIYHGPSAFSEPESKAYSQFLTSLK 321

  Fly   324 GKEQIKTYIALHSYSQMLMFPYGYTKERVSNYDDLQEFGKKASAAIKAENGR----DYVSGSLFE 384
            |:  ::.||.||||||:.:  |.|:..:.:...|::|..:.|:.|:: |.||    .|..|:..|
 Worm   322 GR--LEAYITLHSYSQLWI--YSYSHRKFTYAPDIEETRRVAAKAVQ-ELGRMYGTKYRHGTGPE 381

  Fly   385 TIYPSSGGSMDWAHSEAGIPIAYTFELRGPPDSQDL-----FILPAVEIQPTASEAFTAIRAIVE 444
            .||..||||.|||.....|..:||.|||  |..:.:     |:|...::.|||.|.:..:..:::
 Worm   382 IIYAFSGGSTDWAKETLKIKYSYTIELR--PGYEGIIEWNGFVLDKNQLIPTAKETWAGVTVVLD 444

  Fly   445  444
             Worm   445  444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2915NP_610338.1 MpaA 50..433 CDD:225421 127/431 (29%)
Propep_M14 63..133 CDD:280416 19/74 (26%)
M14_CP_A-B_like 153..446 CDD:199844 104/318 (33%)
Y47G6A.19NP_001379340.1 Propep_M14 32..102 CDD:396700 20/76 (26%)
M14_CP_A-B_like 134..446 CDD:349433 104/318 (33%)
ShK 467..504 CDD:396228
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47975
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100142
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.