DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2915 and AGBL1

DIOPT Version :9

Sequence 1:NP_610338.1 Gene:CG2915 / 35754 FlyBaseID:FBgn0033241 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001373023.1 Gene:AGBL1 / 123624 HGNCID:26504 Length:1121 Species:Homo sapiens


Alignment Length:311 Identity:70/311 - (22%)
Similarity:113/311 - (36%) Gaps:84/311 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 PESIDASQLDWQHFFHLKTIYEWLDKMVEKYPN------RVTVL--DMGSSTQGNAIKGVKLTS- 195
            |.|.|...|.:.:.:....:...|| ::||..|      |..||  .:|    ||....|.:|: 
Human   720 PHSEDVCYLAYHYPYTYTALMTHLD-ILEKSVNLKEVYFRQDVLCQTLG----GNPCPLVTITAM 779

  Fly   196 NANNKAIFIESGIH-------AREWISPAAATYIIN---QLLTSQDPKVQQLAQDYNWIIFPCVN 250
            ..:|....:|...|       ||.....:.|::::.   :.|.|.||..:.|.:::.:.|.|.:|
Human   780 PESNSDEHLEQFRHRPYQVITARVHPGESNASWVMKGTLEFLVSSDPVARLLRENFIFKIIPMLN 844

  Fly   251 PDGYKYTFEHDRMWRKNRQLFGTCR----GVDLNRNYPDHWNSTGSSSDPTRYDFAGPSAGSELE 311
            |||.               :.|..|    |.||||    .|.|..:...||.|...|        
Human   845 PDGV---------------INGNHRCSLSGEDLNR----QWLSPSAHLQPTIYHAKG-------- 882

  Fly   312 TKRLIDFIRANAGKEQIKTYIALHSYSQML-MFPYGYT-KERV---------------SNYDDLQ 359
                :.:..::.|:..: .:...|.:||.. :|.||.: ||.:               .||..|.
Human   883 ----LLYHLSSIGRSPV-VFCDFHGHSQKKNVFLYGCSIKETLWQAACTVGTSTILEEVNYRTLP 942

  Fly   360 EFGKKASAAIKAENGRDYVSGSLFETIYPSSGGSMDWAHSEAGIPIAYTFE 410
            :...|.:.|....:     ...|.|....|:...:.|  .|.|:..:||.|
Human   943 KILDKLAPAFTMSS-----CSFLVEKSRASTARVVVW--REMGVSRSYTME 986

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2915NP_610338.1 MpaA 50..433 CDD:225421 70/311 (23%)
Propep_M14 63..133 CDD:280416
M14_CP_A-B_like 153..446 CDD:199844 66/298 (22%)
AGBL1NP_001373023.1 Pepdidase_M14_N 596..730 CDD:407865 4/9 (44%)
M14_Nna1 754..1019 CDD:349477 61/276 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.