DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2915 and LOC100490370

DIOPT Version :9

Sequence 1:NP_610338.1 Gene:CG2915 / 35754 FlyBaseID:FBgn0033241 Length:453 Species:Drosophila melanogaster
Sequence 2:XP_031749426.1 Gene:LOC100490370 / 100490370 -ID:- Length:491 Species:Xenopus tropicalis


Alignment Length:422 Identity:122/422 - (28%)
Similarity:224/422 - (53%) Gaps:35/422 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CRGNPPDQARYDNYRIYNVEFENQEQIELFQKLEEQSDSLTFIG--HAREVGQKLSILVAAHRVA 107
            |.|     ..||...|..:..|:::|::..|.: .||..|..:.  ...::..|.::.|   |:.
 Frog    57 CTG-----TEYDGGNILEITPESEKQVQCLQNI-LQSWLLDLLKPLQPEDINVKTTVHV---RIP 112

  Fly   108 DIADLLKTYKVKHRVLTYNFQ-EKIDRNLAEVQPESIDA-------SQLDWQHFFHLKTIYEWLD 164
            ..|..|    ||..:|..:.. |.:..|:..::.:.||.       ::.::..:..:..||:|::
 Frog   113 STALQL----VKEDLLHCSQSLEILTGNVKYIEEDKIDTKETRKTINEYNYTTYHPMNEIYDWIN 173

  Fly   165 KMVEKYPNRVTVLDMGSSTQGNAIKGVKLTSNANN--KAIFIESGIHAREWISPAAATYIINQLL 227
            .:.:|:...||...:|.:.:...::.:|::..:.|  |.::|:.||||||||:||...:.:.:.:
 Frog   174 GIAKKHSQFVTQHLLGLTYESRPMQYLKISQPSENHKKIVWIDCGIHAREWIAPAFCQWFVKEQI 238

  Fly   228 T---SQDPKVQQLAQDYNWIIFPCVNPDGYKYTFEHDRMWRKNRQLF--GTCRGVDLNRNYPDHW 287
            .   ..|.:::::.|:.:..:.|.:|.|||.|::..:|:|||||..:  |||.|||||||:...|
 Frog   239 VQNYQNDQRIRKILQNLDIYVLPVLNIDGYIYSWTKERLWRKNRSQYGNGTCYGVDLNRNFNVSW 303

  Fly   288 NSTGSSSDPTRYDFAGPSAGSELETKRLIDFIRANAGKEQIKTYIALHSYSQMLMFPYGYTKERV 352
            .:..||::.:...|.|.|..||.||:.:::|:.:.  |..|..::.:|||||:::..|||:....
 Frog   304 CTHRSSTNCSSNSFCGSSPVSEPETRAVVEFVESR--KADIVCFLTMHSYSQLILTAYGYSTGLS 366

  Fly   353 SNYDDLQEFGKKASAAIKAENGRDYVSGSLFETIYPSSGGSMDWAHSEAGIPIAYTFELRGPPDS 417
            .||:::.:..:.|::|::..:|..|.:|...:.:|.:||.|.||.| :.||..::|||||  .:.
 Frog   367 RNYNEIFKVAEMAASAMEKIHGTKYRAGPFSKLLYEASGTSQDWVH-DLGIDFSFTFELR--DNG 428

  Fly   418 QDLFILPAVEIQPTASEAFTAIRAIVEAAAEK 449
            ...|.||..:||||..|....:..|:|...||
 Frog   429 SHKFTLPEDQIQPTCEETMAGVMTIIEYVNEK 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2915NP_610338.1 MpaA 50..433 CDD:225421 115/399 (29%)
Propep_M14 63..133 CDD:280416 15/72 (21%)
M14_CP_A-B_like 153..446 CDD:199844 97/299 (32%)
LOC100490370XP_031749426.1 Propep_M14 73..>123 CDD:396700 13/57 (23%)
Peptidase_M14_like 159..457 CDD:416253 97/302 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H119965
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.