DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and CABP1

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_016875724.1 Gene:CABP1 / 9478 HGNCID:1384 Length:405 Species:Homo sapiens


Alignment Length:138 Identity:40/138 - (28%)
Similarity:75/138 - (54%) Gaps:5/138 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPEFCNV 71
            ||...:.:.||..|||.:|.|..:::...:|.:|..|.:.|:..:..:::....|.:...:|..:
Human   225 EEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVEL 289

  Fly    72 ----ILRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVF-TALGVKLSDDELEEMIREYDLD 131
                :|.:..|.....|||:|||.||.:.:|.|:|:||:... ..||.::...::||:||:.||:
Human   290 MGPKLLAETADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLN 354

  Fly   132 QDNHLNYE 139
            .|..:::|
Human   355 GDGRVDFE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 40/138 (29%)
EFh 12..72 CDD:238008 13/63 (21%)
EFh 84..146 CDD:238008 23/57 (40%)
CABP1XP_016875724.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.