DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and EFCAB11

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_660274.1 Gene:EFCAB11 / 90141 HGNCID:20357 Length:163 Species:Homo sapiens


Alignment Length:130 Identity:34/130 - (26%)
Similarity:71/130 - (54%) Gaps:2/130 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LDTFRILDKDNEGAITSKEM-AVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPEFCNVILRKM 76
            ::.|:..|:|::|.::.::. ..|:...|.:|:..||.|:::.::...:| |:...|.|::.:|.
Human    24 VEVFKACDEDHKGYLSREDFKTAVVMLFGYKPSKIEVDSVMSSINPNTSG-ILLEGFLNIVRKKK 87

  Fly    77 RDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHLNYEEF 141
            ....:.:|:|..|..||....|::|..:.|..|..:..||.:..:.|:.||.|.|.|.|:::.:|
Human    88 EAQRYRNEVRHIFTAFDTYYRGFLTLEDFKKAFRQVAPKLPERTVLEVFREVDRDSDGHVSFRDF 152

  Fly   142  141
            Human   153  152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 34/130 (26%)
EFh 12..72 CDD:238008 14/59 (24%)
EFh 84..146 CDD:238008 19/58 (33%)
EFCAB11NP_660274.1 EFh_PEF 14..152 CDD:330173 33/128 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.