DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and AT1G12310

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_172695.1 Gene:AT1G12310 / 837785 AraportID:AT1G12310 Length:148 Species:Arabidopsis thaliana


Alignment Length:151 Identity:38/151 - (25%)
Similarity:87/151 - (57%) Gaps:10/151 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EDISHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAP 66
            :.:|.::...:.:.|.:.|.|.:|.|...|:.:::|:||..|..|:::|:|      .:.::.:|
plant     4 DGLSDDQVSSMKEAFMLFDTDGDGKIAPSELGILMRSLGGNPTQAQLKSII------ASENLSSP 62

  Fly    67 ----EFCNVILRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIRE 127
                .|.:::.:.::....:.:||:||::.||:..|::...:|:::.|::|.||..:|.:|.|:|
plant    63 FDFNRFLDLMAKHLKTEPFDRQLRDAFKVLDKEGTGFVAVADLRHILTSIGEKLEPNEFDEWIKE 127

  Fly   128 YDLDQDNHLNYEEFVNMMTMR 148
            .|:..|..:.||:|:..|..:
plant   128 VDVGSDGKIRYEDFIARMVAK 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 38/149 (26%)
EFh 12..72 CDD:238008 15/63 (24%)
EFh 84..146 CDD:238008 21/61 (34%)
AT1G12310NP_172695.1 PTZ00184 4..148 CDD:185504 38/149 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.970

Return to query results.
Submit another query.