DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and CP1

DIOPT Version :10

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_199759.1 Gene:CP1 / 835008 AraportID:AT5G49480 Length:160 Species:Arabidopsis thaliana


Alignment Length:130 Identity:33/130 - (25%)
Similarity:72/130 - (55%) Gaps:6/130 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FRILDKDNEGAITSKEMAVVIRAL--GRQPNDAEVQSMINEVDSEGNGSIVAPEFCNVILRK--M 76
            |.|:|.|::|.|:|.::......:  |...::..:.:||:..|:..:|.:...||..|:...  .
plant    23 FEIIDTDHDGKISSDDLRAFYAGIPSGENNDETMIGTMISVADANKDGFVEFDEFEKVLETTPFS 87

  Fly    77 RDTNHEDE--LREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHLNYE 139
            |..|..|:  :::.|::.|||.:|.::..:||:...:.|:.::|||::.|||....|.::.::::
plant    88 RSGNGGDDGLMKDVFKVMDKDGDGRLSYGDLKSYMDSAGLAVTDDEIKSMIRLAGGDLNDGVSFD 152

  Fly   140  139
            plant   153  152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 33/130 (25%)
CP1NP_199759.1 FRQ1 13..158 CDD:444056 33/130 (25%)

Return to query results.
Submit another query.