DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and CAM9

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_190760.1 Gene:CAM9 / 824355 AraportID:AT3G51920 Length:151 Species:Arabidopsis thaliana


Alignment Length:146 Identity:51/146 - (34%)
Similarity:89/146 - (60%) Gaps:1/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDISHEERVL-ILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIV 64
            |.|...:|::. ..:.|.::|||::|.||.:::..|::::|:.|...::|.|:::||..|||.|.
plant     1 MADAFTDEQIQEFYEAFCLIDKDSDGFITKEKLTKVMKSMGKNPKAEQLQQMMSDVDIFGNGGIT 65

  Fly    65 APEFCNVILRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYD 129
            ..:|..::.:.....:..|||.|.||:||:|.:|.|:..||......:|:|::.:|.|.|:||.|
plant    66 FDDFLYIMAQNTSQESASDELIEVFRVFDRDGDGLISQLELGEGMKDMGMKITAEEAEHMVREAD 130

  Fly   130 LDQDNHLNYEEFVNMM 145
            ||.|..|::.||..||
plant   131 LDGDGFLSFHEFSKMM 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 51/146 (35%)
EFh 12..72 CDD:238008 19/59 (32%)
EFh 84..146 CDD:238008 28/62 (45%)
CAM9NP_190760.1 PTZ00184 1..148 CDD:185504 51/146 (35%)
EFh 12..74 CDD:238008 19/61 (31%)
EFh 85..146 CDD:238008 26/60 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.