DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and CEN2

DIOPT Version :10

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_190605.1 Gene:CEN2 / 824198 AraportID:AT3G50360 Length:169 Species:Arabidopsis thaliana


Alignment Length:45 Identity:10/45 - (22%)
Similarity:19/45 - (42%) Gaps:6/45 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 SIILSNLFCTPIAARMVVTAFPDLKILTSEL------HPVAPNHF 220
            |.|:.:..|..:...:.:|.|....:::|.:      ...|.|||
plant   130 SSIIDHKVCVKLVILLWLTGFGVSLVMSSSIGTLVFCKQTAINHF 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504
CEN2NP_190605.1 PTZ00183 19..164 CDD:185503 6/33 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.