DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and AT3G25600

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_189188.4 Gene:AT3G25600 / 822147 AraportID:AT3G25600 Length:161 Species:Arabidopsis thaliana


Alignment Length:137 Identity:48/137 - (35%)
Similarity:79/137 - (57%) Gaps:8/137 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPEFCNVILRKMRD 78
            |.|...|.|.:|::|..|:|.::|:||.:|...::..::|::|..||||:   ||..:::..:.|
plant    15 DIFARFDMDKDGSLTQLELAALLRSLGIKPRGDQISLLLNQIDRNGNGSV---EFDELVVAILPD 76

  Fly    79 TNHE-----DELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHLNY 138
            .|.|     ::|.|.||.||:|.||.||..||......:|..|:..||.||:.|.|.:.|..:::
plant    77 INEEVLINQEQLMEVFRSFDRDGNGSITAAELAGSMAKMGHPLTYRELTEMMTEADSNGDGVISF 141

  Fly   139 EEFVNMM 145
            .||.::|
plant   142 NEFSHIM 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 48/137 (35%)
EFh 12..72 CDD:238008 20/57 (35%)
EFh 84..146 CDD:238008 25/62 (40%)
AT3G25600NP_189188.4 PTZ00184 1..148 CDD:185504 47/135 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.