DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and CML11

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_188933.1 Gene:CML11 / 821865 AraportID:AT3G22930 Length:173 Species:Arabidopsis thaliana


Alignment Length:144 Identity:66/144 - (45%)
Similarity:108/144 - (75%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EDISHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAP 66
            ::::.|:.:...:.|.:.|||.:|.||:.|:|.|||:|.:.|.:.|:|.||.|:||:|||:|...
plant    26 QELTQEQIMEFKEAFCLFDKDGDGCITADELATVIRSLDQNPTEQELQDMITEIDSDGNGTIEFS 90

  Fly    67 EFCNVILRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLD 131
            ||.|::..::::|:.::||:|||::||||.||||:.:||::|...||.||:|:|:::||:|.|||
plant    91 EFLNLMANQLQETDADEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVDQMIKEADLD 155

  Fly   132 QDNHLNYEEFVNMM 145
            .|..:||:|||.||
plant   156 GDGQVNYDEFVRMM 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 66/144 (46%)
EFh 12..72 CDD:238008 28/59 (47%)
EFh 84..146 CDD:238008 36/62 (58%)
CML11NP_188933.1 PTZ00184 27..170 CDD:185504 66/143 (46%)
EFh 35..97 CDD:238008 28/61 (46%)
EFh 108..170 CDD:238008 36/62 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.