DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and Calm4

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_064420.2 Gene:Calm4 / 80796 MGIID:1931464 Length:148 Species:Mus musculus


Alignment Length:145 Identity:53/145 - (36%)
Similarity:86/145 - (59%) Gaps:5/145 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISH----EERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIV 64
            :||    ||.......|...||:.:|.|:.:|:..|::.||:...:.:::::|:::|::|:|.|.
Mouse     1 MSHGFTKEEVAEFQAAFNRFDKNKDGHISVEELGDVMKQLGKNLPEKDLKALISKLDTDGDGKIS 65

  Fly    65 APEFCNVILRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYD 129
            ..||...| .|.:..:...|||..|.:.|::.:||||..|||...:.||..||.:|||:|||..|
Mouse    66 FEEFLTAI-EKYKKGHRAGELRAVFNVLDQNGDGYITVDELKESLSKLGESLSQEELEDMIRVAD 129

  Fly   130 LDQDNHLNYEEFVNM 144
            :|||..:.|||||.:
Mouse   130 VDQDGKVKYEEFVRL 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 53/145 (37%)
EFh 12..72 CDD:238008 16/59 (27%)
EFh 84..146 CDD:238008 31/61 (51%)
Calm4NP_064420.2 PTZ00184 1..148 CDD:185504 53/145 (37%)
EFh 12..73 CDD:238008 16/60 (27%)
EFh 84..145 CDD:238008 31/61 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D600030at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.