DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and Efcab11

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_084448.1 Gene:Efcab11 / 78767 MGIID:1926017 Length:162 Species:Mus musculus


Alignment Length:140 Identity:36/140 - (25%)
Similarity:73/140 - (52%) Gaps:2/140 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DISHEERVLILDTFRILDKDNEGAITSKEMAV-VIRALGRQPNDAEVQSMINEVDSEGNGSIVAP 66
            :.|..||...:..|:..|:||:|.::.::..| ::...|.:|:..|..::::.|:...:| :...
Mouse    14 EASASERRKWVKVFKACDEDNKGYLSREDFKVAIVMLFGYKPSKIEADAVMSSVNPNTSG-VSLE 77

  Fly    67 EFCNVILRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLD 131
            .|.:.:.||.....:.:|:|:.|..||....|::|..:.|..|:.:..||....:.|:.||.|.|
Mouse    78 GFLSAVKRKKEARLYRNEIRQIFTAFDVHYRGFLTLEDFKRAFSRVAPKLPARTVLEVFREADQD 142

  Fly   132 QDNHLNYEEF 141
            .|.|:::.:|
Mouse   143 SDGHVSFRDF 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 36/140 (26%)
EFh 12..72 CDD:238008 12/60 (20%)
EFh 84..146 CDD:238008 19/58 (33%)
Efcab11NP_084448.1 FRQ1 14..152 CDD:227455 35/138 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2829
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.