DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and Calml4

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_612177.1 Gene:Calml4 / 75600 MGIID:1922850 Length:153 Species:Mus musculus


Alignment Length:134 Identity:34/134 - (25%)
Similarity:70/134 - (52%) Gaps:0/134 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPEFCNVILRKMRD 78
            :.|.:.||...|.|.:.::.|.:|.||..|...|||..:.....:.||.:....|..::..:::.
Mouse    15 ECFSLYDKQQRGKIKATDLLVSMRCLGASPTPGEVQRHLQTHGIDKNGELDFSTFLTIMHMQIKQ 79

  Fly    79 TNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHLNYEEFVN 143
            .:.:.|:..|..:.||:..|||..:||::....||.||:..|::::.:|..::.:..:.|:.|:.
Mouse    80 EDPKKEILLAMLMADKEKKGYIMASELRSKLMKLGEKLTHKEVDDLFKEAGIEPNGQVKYDTFIQ 144

  Fly   144 MMTM 147
            .:|:
Mouse   145 RITI 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 34/134 (25%)
EFh 12..72 CDD:238008 16/57 (28%)
EFh 84..146 CDD:238008 17/61 (28%)
Calml4NP_612177.1 PTZ00184 1..144 CDD:185504 33/128 (26%)
EFh 12..74 CDD:238008 16/58 (28%)
EFh 94..147 CDD:298682 15/52 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.