DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and TNNC2

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_003270.1 Gene:TNNC2 / 7125 HGNCID:11944 Length:160 Species:Homo sapiens


Alignment Length:133 Identity:50/133 - (37%)
Similarity:86/133 - (64%) Gaps:3/133 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPEFCNVILRKMRDT- 79
            |.:.|.|..|.|:.||:..|:|.||:.|...|:.::|.|||.:|:|:|...||..:::|:|::. 
Human    24 FDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDA 88

  Fly    80 --NHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHLNYEEFV 142
              ..|:||.|.|||||::.:|||...||..:|.|.|..::|:|:|.::::.|.:.|..::::||:
Human    89 KGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFL 153

  Fly   143 NMM 145
            .||
Human   154 KMM 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 50/133 (38%)
EFh 12..72 CDD:238008 22/55 (40%)
EFh 84..146 CDD:238008 25/62 (40%)
TNNC2NP_003270.1 PTZ00184 12..156 CDD:185504 48/131 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.