DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and Myl4

DIOPT Version :10

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001102965.1 Gene:Myl4 / 688228 RGDID:1591197 Length:193 Species:Rattus norvegicus


Alignment Length:148 Identity:45/148 - (30%)
Similarity:78/148 - (52%) Gaps:11/148 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DISHEERVLILDTFRILDKDNEG--AITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGS--- 62
            |.|.::.....:.|.:.|:...|  .||..:...|:||||:.|.:|||..::.:...|...|   
  Rat    43 DFSADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNSKTL 107

  Fly    63 ---IVAPEFCNVILRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEM 124
               :..|...::...|.:.| :||.: |..|:|||::||.:...||::|...||.|:|:.|:|::
  Rat   108 DFEMFLPILQHISRNKEQGT-YEDFV-EGLRVFDKESNGTVMGAELRHVLATLGEKMSEAEVEQL 170

  Fly   125 IREYDLDQDNHLNYEEFV 142
            :...: |.:..:|||.||
  Rat   171 LTGQE-DANGCINYEAFV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 45/148 (30%)
Myl4NP_001102965.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
PTZ00184 45..192 CDD:185504 44/146 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.