DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and Myl4

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001102965.1 Gene:Myl4 / 688228 RGDID:1591197 Length:193 Species:Rattus norvegicus


Alignment Length:148 Identity:45/148 - (30%)
Similarity:78/148 - (52%) Gaps:11/148 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DISHEERVLILDTFRILDKDNEG--AITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGS--- 62
            |.|.::.....:.|.:.|:...|  .||..:...|:||||:.|.:|||..::.:...|...|   
  Rat    43 DFSADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNSKTL 107

  Fly    63 ---IVAPEFCNVILRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEM 124
               :..|...::...|.:.| :||.: |..|:|||::||.:...||::|...||.|:|:.|:|::
  Rat   108 DFEMFLPILQHISRNKEQGT-YEDFV-EGLRVFDKESNGTVMGAELRHVLATLGEKMSEAEVEQL 170

  Fly   125 IREYDLDQDNHLNYEEFV 142
            :...: |.:..:|||.||
  Rat   171 LTGQE-DANGCINYEAFV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 45/148 (30%)
EFh 12..72 CDD:238008 17/67 (25%)
EFh 84..146 CDD:238008 22/59 (37%)
Myl4NP_001102965.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
PTZ00184 45..192 CDD:185504 44/146 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.