DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and mylz3

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_571694.1 Gene:mylz3 / 58143 ZFINID:ZDB-GENE-000322-6 Length:151 Species:Danio rerio


Alignment Length:140 Identity:39/140 - (27%)
Similarity:79/140 - (56%) Gaps:9/140 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINE--VDSEGNGSIVAPEFCNVILRKM 76
            :.|.:.|:..:..:...::|.::||||:.|.:.:|:.::.:  .|...|..|....|..::  |.
Zfish    15 EAFGLFDRVGDSKVAYNQVADIMRALGQNPTNKDVKKILGDPSADDMANKRIDFEAFLPML--KT 77

  Fly    77 RDTNHE---DELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHLNY 138
            .|.|.:   |:..|..|:|||:.||.:...||:.|.:.||.|:|:.|::.:::..: |::..::|
Zfish    78 VDANQKGTYDDYVEGLRVFDKEGNGTVMGAELRIVLSTLGEKMSEPEIDALMQGQE-DENGMVHY 141

  Fly   139 EEFV-NMMTM 147
            |.|| |:|::
Zfish   142 EAFVKNIMSV 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 39/140 (28%)
EFh 12..72 CDD:238008 13/59 (22%)
EFh 84..146 CDD:238008 21/62 (34%)
mylz3NP_571694.1 PTZ00184 1..150 CDD:185504 38/137 (28%)
EFh 12..76 CDD:298682 13/62 (21%)
EFh 94..146 CDD:238008 18/52 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.