DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and scgn

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001005776.1 Gene:scgn / 573010 ZFINID:ZDB-GENE-041010-82 Length:272 Species:Danio rerio


Alignment Length:164 Identity:37/164 - (22%)
Similarity:75/164 - (45%) Gaps:28/164 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LDTFRILDKDNEGAITSKEMAVVIRALGR--QPNDAEVQSMINEV--------DSEGNGSIVAPE 67
            |..::..|.|:.|.|..||:....|.:.:  ||.|......:.::        |:..:|.:...|
Zfish    14 LQIWQHFDADDNGYIEGKELDDFFRHMLKKLQPKDKITDERVQQIKKSFMSAYDATFDGRLQIEE 78

  Fly    68 FCNVIL----------RKMRDTNHEDELREAFRIFDKDNNGYITTTELKN----VFTALGVKLSD 118
            ..|:||          |:....::..|..:.:|.:|.|::|||:..||||    :|.....|:..
Zfish    79 LANMILPQEENFLLIFRREAPLDNSVEFMKIWRKYDADSSGYISAAELKNFLKDLFLQHKKKIPP 143

  Fly   119 DELEE----MIREYDLDQDNHLNYEEFVNMMTMR 148
            ::|:|    |::.:|.::|..|:..:...::.::
Zfish   144 NKLDEYTDAMMKIFDKNKDGRLDLNDLARILALQ 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 37/162 (23%)
EFh 12..72 CDD:238008 15/68 (22%)
EFh 84..146 CDD:238008 19/69 (28%)
scgnNP_001005776.1 EFh 13..83 CDD:298682 15/68 (22%)
EF-hand_7 15..83 CDD:290234 14/67 (21%)
EFh 105..175 CDD:238008 19/69 (28%)
EF-hand_7 107..174 CDD:290234 18/66 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.