DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and cabp2a

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001025439.2 Gene:cabp2a / 572226 ZFINID:ZDB-GENE-050913-25 Length:236 Species:Danio rerio


Alignment Length:150 Identity:48/150 - (32%)
Similarity:83/150 - (55%) Gaps:10/150 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DISHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINE-----VDSEGNGS 62
            |:..||...:.:.||..|||.:|.|:.|::...:|.:|..|.:.|:..:..:     ||.|....
Zfish    90 DLRPEEIEELKEAFREFDKDKDGFISCKDLGECMRTMGYMPTEMELIELSQQICGGRVDFEDFVD 154

  Fly    63 IVAPEFCNVILRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTAL-GVKLSDDELEEMIR 126
            ::.|:    :|.:..|.....|||:|||.||.:.:|.|:..||:.....| |.:|:..|::|::|
Zfish   155 LMGPK----MLAETADMIGVKELRDAFREFDSNGDGQISLAELREAMKKLMGEQLNHREIDEILR 215

  Fly   127 EYDLDQDNHLNYEEFVNMMT 146
            :.||:.|..:::||||.||:
Zfish   216 DVDLNGDGLVDFEEFVRMMS 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 48/149 (32%)
EFh 12..72 CDD:238008 16/64 (25%)
EFh 84..146 CDD:238008 26/62 (42%)
cabp2aNP_001025439.2 PTZ00184 91..234 CDD:185504 45/146 (31%)
EFh 98..198 CDD:238008 30/103 (29%)
EFh 172..235 CDD:238008 26/62 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.