DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and calml4a

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001124246.1 Gene:calml4a / 560151 ZFINID:ZDB-GENE-081022-9 Length:153 Species:Danio rerio


Alignment Length:136 Identity:44/136 - (32%)
Similarity:79/136 - (58%) Gaps:4/136 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DTFRILDKDNEGAITSKEMAVVIRALGRQP--NDAEVQSMINEVDSEGNGSIVAPEFCNVILRKM 76
            :.|.:.||..:|.|.:|::..|:|.||..|  |:.:....::::|.  .|.:....|..::.|:|
Zfish    15 ECFSLYDKKRKGKIEAKDLITVMRCLGTSPTYNEVDRHLQVHKIDK--TGELDFSTFLTMMHRQM 77

  Fly    77 RDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHLNYEEF 141
            :..:.:.|:.||.|:.||...|||..:||:...|.||.||:|.|::|:.:|..:.:|..::||||
Zfish    78 QQEDPKTEILEAMRMTDKHKKGYIQASELRAKLTGLGEKLTDKEVDELFKEAHVGRDGLVHYEEF 142

  Fly   142 VNMMTM 147
            ..|:|:
Zfish   143 TRMVTL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 44/136 (32%)
EFh 12..72 CDD:238008 15/59 (25%)
EFh 84..146 CDD:238008 26/61 (43%)
calml4aNP_001124246.1 PTZ00184 1..147 CDD:185504 43/133 (32%)
EFh 12..74 CDD:238008 15/60 (25%)
EFh 85..147 CDD:238008 26/61 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.