DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and cabp5b

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001018568.1 Gene:cabp5b / 553766 ZFINID:ZDB-GENE-050522-146 Length:169 Species:Danio rerio


Alignment Length:148 Identity:44/148 - (29%)
Similarity:81/148 - (54%) Gaps:5/148 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPEF 68
            ::.||...:.:.|...|||.:|.|:.|::..::|.:|..|.:.|:..:...::....||:...:|
Zfish    20 LADEEIDELREAFTEFDKDKDGLISCKDLGNLMRTMGYMPTEMELIELSQNINMNLGGSVDFQDF 84

  Fly    69 CNVILRKMRDTNHE----DELREAFRIFDKDNNGYITTTELK-NVFTALGVKLSDDELEEMIREY 128
            .:::..|:......    .||::||:.||.|.:|.|||.||: .:...||...:..|:|.::||.
Zfish    85 VDLMAPKLLAETAGMIGIKELKDAFKEFDMDGDGSITTEELRLAMLKLLGENTNRREVEAVVREV 149

  Fly   129 DLDQDNHLNYEEFVNMMT 146
            |.:.|..:::||||.||:
Zfish   150 DNNGDGTVDFEEFVKMMS 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 44/148 (30%)
EFh 12..72 CDD:238008 14/59 (24%)
EFh 84..146 CDD:238008 26/62 (42%)
cabp5bNP_001018568.1 PTZ00184 20..166 CDD:185504 42/145 (29%)
EFh 27..89 CDD:238008 14/61 (23%)
EFh 104..167 CDD:238008 26/62 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.