DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and efcab11

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001017812.1 Gene:efcab11 / 550510 ZFINID:ZDB-GENE-050417-348 Length:167 Species:Danio rerio


Alignment Length:151 Identity:36/151 - (23%)
Similarity:74/151 - (49%) Gaps:15/151 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISHEERVLILDTFRILDKDNEGAITSKEMAV-VIRALGRQPNDAEVQSMINEVDSEGNGSI---- 63
            |:..||..|...|...|.|.:|.::.:::.: |:...|.:|:.:|...::.      ||:|    
Zfish    14 INDAERKKIELVFHQCDVDKKGYMSREDLKIAVVMLFGYKPSKSETNILME------NGTIRDCK 72

  Fly    64 ---VAPEFCNVILRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMI 125
               :.| |..::.|||...:..::.|:.|..||....|::...:.|:.|..:..:|.:..:.|..
Zfish    73 GVPLEP-FATLMRRKMSAEDPYEKARQIFSAFDVHCRGFLKLDDFKSAFKRVAPRLQERTVLEAF 136

  Fly   126 REYDLDQDNHLNYEEFVNMMT 146
            |..|.|.|.|:::::|.|:::
Zfish   137 RHADQDSDGHISFKDFENIIS 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 36/151 (24%)
EFh 12..72 CDD:238008 14/67 (21%)
EFh 84..146 CDD:238008 16/61 (26%)
efcab11NP_001017812.1 PTZ00183 9..156 CDD:185503 36/148 (24%)
EFh 95..152 CDD:238008 14/56 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.