DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and CALML5

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_059118.2 Gene:CALML5 / 51806 HGNCID:18180 Length:146 Species:Homo sapiens


Alignment Length:143 Identity:56/143 - (39%)
Similarity:86/143 - (60%) Gaps:3/143 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DISHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPE 67
            :::.||.......|..:|.|..|.|.::|:...::|.|:..::|:::.:|:||||:|:|.|...|
Human     4 ELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQE 68

  Fly    68 FCNVILRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQ 132
            |... .:|.| ...|| |:.|||.||:|.:|:||..||:.....||..|..:||:.||||.|:||
Human    69 FLTA-AKKAR-AGLED-LQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQ 130

  Fly   133 DNHLNYEEFVNMM 145
            |..:|||||..|:
Human   131 DGRVNYEEFARML 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 56/143 (39%)
EFh 12..72 CDD:238008 19/59 (32%)
EFh 84..146 CDD:238008 31/62 (50%)
CALML5NP_059118.2 PTZ00184 1..143 CDD:185504 55/141 (39%)
EFh 12..74 CDD:238008 19/62 (31%)
EFh 82..144 CDD:238008 32/63 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D600030at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.