DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and MYL1

DIOPT Version :10

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_524144.1 Gene:MYL1 / 4632 HGNCID:7582 Length:194 Species:Homo sapiens


Alignment Length:146 Identity:43/146 - (29%)
Similarity:78/146 - (53%) Gaps:9/146 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DISHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMI-NEVDSEGNGSIVAP 66
            :.|.|::....:.|.:.|:..:..||..::..|:||||..|.:|||:.:: |..:.|.|...:  
Human    46 EFSKEQQDEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKI-- 108

  Fly    67 EFCNVILRKMRDTNHEDELR-----EAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIR 126
            ||...:......:|::|:..     |..|:|||:.||.:...||::|...||.|:.::|:|.::.
Human   109 EFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMA 173

  Fly   127 EYDLDQDNHLNYEEFV 142
            ..: |.:..:|||.||
Human   174 GQE-DSNGCINYEAFV 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 43/146 (29%)
MYL1NP_524144.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
PTZ00184 45..193 CDD:185504 43/146 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.