DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and CG17770

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_651432.1 Gene:CG17770 / 43118 FlyBaseID:FBgn0039374 Length:164 Species:Drosophila melanogaster


Alignment Length:141 Identity:43/141 - (30%)
Similarity:88/141 - (62%) Gaps:1/141 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EERVLILD-TFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPEFCN 70
            ||:|..|: .|.:.|..:...|....:..::.::...|:|.|:|.:..|:|::|:|.:...:|.:
  Fly    22 EEQVKDLEIAFSLFDDQDTKVIPITNLRQLMLSVAHYPSDMELQEIQAEIDADGSGELYLSDFLH 86

  Fly    71 VILRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNH 135
            ::.::..:.:.|||:..|||:|||:..|.|:.:|.:::...:|.:|:|||:||:||:.:.|.:.:
  Fly    87 IMSQRYANMSTEDEIIAAFRVFDKEGTGLISESEFRHIMQNMGEQLTDDEVEEIIRDANSDLEGN 151

  Fly   136 LNYEEFVNMMT 146
            ::|..||.||:
  Fly   152 IDYVRFVRMMS 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 43/141 (30%)
EFh 12..72 CDD:238008 13/60 (22%)
EFh 84..146 CDD:238008 24/61 (39%)
CG17770NP_651432.1 PTZ00184 19..161 CDD:185504 41/138 (30%)
EFh 27..89 CDD:298682 13/61 (21%)
EFh 63..126 CDD:238008 19/62 (31%)
EFh 100..162 CDD:238008 24/61 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443647
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BAEQ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.