DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and myl3

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_989012.1 Gene:myl3 / 394608 XenbaseID:XB-GENE-946570 Length:188 Species:Xenopus tropicalis


Alignment Length:135 Identity:36/135 - (26%)
Similarity:74/135 - (54%) Gaps:9/135 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DTFRILDKDN--EGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPEFCNVI---- 72
            :.|.:.|:..  |..||..:...|:||||:.|.:|||..::.:..:| ..|:...:|...:    
 Frog    49 EAFSLFDRTPKCEQKITYGQCGDVLRALGQNPTNAEVLKVLGKPKAE-ELSLKLMDFDTFLPMLQ 112

  Fly    73 -LRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHL 136
             :.|.::....::..|..|:|||:.||.:...|:::|...||.:::::|::.:::..: |.:.|:
 Frog   113 HISKSKEKGTYEDFVEGLRVFDKEGNGTVMGAEIRHVLATLGERMTEEEVDRLLQGQE-DPNGHI 176

  Fly   137 NYEEF 141
            |||.|
 Frog   177 NYEAF 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 36/135 (27%)
EFh 12..72 CDD:238008 17/59 (29%)
EFh 84..146 CDD:238008 18/58 (31%)
myl3NP_989012.1 PTZ00184 37..188 CDD:185504 36/135 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.