DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and tnnc2

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_012827046.1 Gene:tnnc2 / 394554 XenbaseID:XB-GENE-480259 Length:163 Species:Xenopus tropicalis


Alignment Length:133 Identity:50/133 - (37%)
Similarity:87/133 - (65%) Gaps:3/133 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPEFCNVILRKMRDT- 79
            |.:.|.|..|.|::||:..|:|.||:.|...|:.::|.|||.:|:|:|...||..:::|:|::. 
 Frog    27 FDMFDTDGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDA 91

  Fly    80 --NHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHLNYEEFV 142
              ..|:||.|.||||||:.:|||...||..:..:.|..::|:|:||::::.|.:.|..::::||:
 Frog    92 QGKSEEELAECFRIFDKNADGYIDGEELAEILRSSGESITDEEIEELMKDGDKNNDGKIDFDEFL 156

  Fly   143 NMM 145
            .||
 Frog   157 KMM 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 50/133 (38%)
EFh 12..72 CDD:238008 22/55 (40%)
EFh 84..146 CDD:238008 25/62 (40%)
tnnc2XP_012827046.1 PTZ00184 15..159 CDD:185504 48/131 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.