DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and cabp5a

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_956992.1 Gene:cabp5a / 393671 ZFINID:ZDB-GENE-040426-1655 Length:165 Species:Danio rerio


Alignment Length:149 Identity:42/149 - (28%)
Similarity:81/149 - (54%) Gaps:5/149 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DISHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPE 67
            :::.:|...:.:.|...|||.:|.|:.|::..::|.:|..|.:.|:..:...::....|.:...:
Zfish    15 ELADDEIEELREAFNEFDKDKDGLISCKDLGNLMRTMGYMPTEMELIELGQNINMNLGGRVDFED 79

  Fly    68 FCNVILRKMRDTN----HEDELREAFRIFDKDNNGYITTTELKNVFT-ALGVKLSDDELEEMIRE 127
            |..::..|:....    ...|||:||:.||.|.:|.|||.||:...| .||..::..|::.::||
Zfish    80 FVELMTPKLLAETAGMIGVKELRDAFKEFDMDGDGAITTEELRCAMTKLLGEHMNRREIDAVVRE 144

  Fly   128 YDLDQDNHLNYEEFVNMMT 146
            .|.:.|..:::||||.|::
Zfish   145 ADNNGDGTVDFEEFVKMLS 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 42/149 (28%)
EFh 12..72 CDD:238008 13/59 (22%)
EFh 84..146 CDD:238008 27/62 (44%)
cabp5aNP_956992.1 PTZ00184 15..164 CDD:185504 42/149 (28%)
EFh 23..85 CDD:238008 13/61 (21%)
EFh 100..163 CDD:238008 27/62 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.