DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and myl13

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_956810.1 Gene:myl13 / 393488 ZFINID:ZDB-GENE-040426-1593 Length:186 Species:Danio rerio


Alignment Length:136 Identity:42/136 - (30%)
Similarity:74/136 - (54%) Gaps:9/136 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DTFRILDK--DNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPEFCNVI---- 72
            |.|::.|:  .||..||..:...:|||||:.|.:|||..::.:...| :..:...:|...:    
Zfish    47 DAFQLFDRTPTNEMKITFAQCGDLIRALGQNPTNAEVLHVLGKPKPE-DMQVKMLDFDQFLPMHQ 110

  Fly    73 -LRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHL 136
             :.|.:|....::..|..|:|||:.||.:...||::|...||.|:.:||:|:::...: |.:..:
Zfish   111 HICKAKDRGTFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEDEVEQLMAGQE-DANGCI 174

  Fly   137 NYEEFV 142
            |||.||
Zfish   175 NYEAFV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 42/136 (31%)
EFh 12..72 CDD:238008 18/59 (31%)
EFh 84..146 CDD:238008 22/59 (37%)
myl13NP_956810.1 PTZ00184 34..185 CDD:185504 42/136 (31%)
EFh 123..184 CDD:238008 22/59 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.