DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and CG13898

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster


Alignment Length:130 Identity:39/130 - (30%)
Similarity:72/130 - (55%) Gaps:0/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPEFCNVILRKM 76
            |.:.|.:.|.:..|.|.:.::..|:|.||:...::|:......::.:.||.|...:|.:::.:..
  Fly    16 ICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNGYIQLTDFIDLMTKIY 80

  Fly    77 RDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHLNYEEF 141
            ......|.|:.|:..||.|.:|.:|..||::||..||.|:||:|..|:.|:.|:|.|..:|:.:|
  Fly    81 SAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFRQADVDGDGVINFRDF 145

  Fly   142  141
              Fly   146  145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 39/130 (30%)
EFh 12..72 CDD:238008 14/59 (24%)
EFh 84..146 CDD:238008 24/58 (41%)
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 39/130 (30%)
EFh 18..77 CDD:298682 13/58 (22%)
EFh 88..148 CDD:238008 24/58 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446165
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.