DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and Cabp4

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_038941368.1 Gene:Cabp4 / 365394 RGDID:1306083 Length:278 Species:Rattus norvegicus


Alignment Length:142 Identity:49/142 - (34%)
Similarity:73/142 - (51%) Gaps:5/142 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DISHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPE 67
            ::..||...:...|...|.|.:|.|..:|:...:|.||..|.:.|:..:...|.....|.:...|
  Rat   121 ELGPEELEELQAAFEEFDTDQDGYIGHRELGDCMRTLGYMPTEMELLEVSQHVKMRMGGFVDFEE 185

  Fly    68 FCNVILRKMR-DTNH---EDELREAFRIFDKDNNGYITTTELKNVFTA-LGVKLSDDELEEMIRE 127
            |..:|..|:| :|.|   ..|||.|||.||||.:|.||..||:....| ||..|...||:||:|:
  Rat   186 FVELISPKLREETAHMLGVRELRIAFREFDKDRDGRITVAELRQAAPALLGEPLEGTELDEMLRD 250

  Fly   128 YDLDQDNHLNYE 139
            .||:.|..::::
  Rat   251 MDLNGDGTIDFD 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 49/142 (35%)
EFh 12..72 CDD:238008 15/59 (25%)
EFh 84..146 CDD:238008 27/57 (47%)
Cabp4XP_038941368.1 PTZ00184 133..262 CDD:185504 47/128 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.