DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and Cabp5

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001102377.1 Gene:Cabp5 / 365194 RGDID:1308108 Length:173 Species:Rattus norvegicus


Alignment Length:138 Identity:40/138 - (28%)
Similarity:75/138 - (54%) Gaps:5/138 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPEFCNVILRKMRD 78
            :.|...|||.:|.|:.|::..::|.:|..|.:.|:..:..::.....|.:...:|..::..|:..
  Rat    35 EAFLEFDKDRDGFISYKDLGNLMRTMGYMPTEMELTELGQQIRMNLGGRVDFEDFVELMTPKLLA 99

  Fly    79 TN----HEDELREAFRIFDKDNNGYITTTELKNVF-TALGVKLSDDELEEMIREYDLDQDNHLNY 138
            ..    ...|:|:||:.||.:.:|.||..||:... ..||.||:..|:.|:::|.|::.|..:::
  Rat   100 ETAGMIGVQEMRDAFKEFDANGDGEITLAELQQAMQRLLGEKLTPREIAEVVQEADINGDGTVDF 164

  Fly   139 EEFVNMMT 146
            ||||.||:
  Rat   165 EEFVKMMS 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 40/138 (29%)
EFh 12..72 CDD:238008 13/57 (23%)
EFh 84..146 CDD:238008 25/62 (40%)
Cabp5NP_001102377.1 PTZ00184 25..171 CDD:185504 38/135 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.