DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and Calml5

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_344628.5 Gene:Calml5 / 364774 RGDID:1310047 Length:147 Species:Rattus norvegicus


Alignment Length:145 Identity:50/145 - (34%)
Similarity:93/145 - (64%) Gaps:6/145 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISH---EERVLIL-DTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIV 64
            :||   :|:|..| ..|..:||:.:|.|..:|:..|::.:|:...:.:::::|:.:|::|:|:|.
  Rat     1 MSHGFTKEQVAELHQAFDRVDKNKDGRINVQELGDVMKQMGKNIPEKDLKALISRIDTDGDGTIS 65

  Fly    65 APEFCNVILRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYD 129
            ..||...:.:..:.:  ::||:..||:||::.:||||..|||...:.:|..||::||.:|||..|
  Rat    66 FEEFLTAMEKYKKGS--KEELQAVFRVFDQNGDGYITMDELKQGLSQMGETLSEEELNDMIRVAD 128

  Fly   130 LDQDNHLNYEEFVNM 144
            .|||..:|||||:.:
  Rat   129 ADQDGKVNYEEFLRV 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 50/145 (34%)
EFh 12..72 CDD:238008 16/60 (27%)
EFh 84..146 CDD:238008 30/61 (49%)
Calml5XP_344628.5 PTZ00184 1..147 CDD:185504 50/145 (34%)
EFh 12..73 CDD:238008 16/60 (27%)
EFh 83..142 CDD:238008 30/58 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D600030at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.