DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and Caln1

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_017453894.1 Gene:Caln1 / 363909 RGDID:1305843 Length:293 Species:Rattus norvegicus


Alignment Length:149 Identity:41/149 - (27%)
Similarity:76/149 - (51%) Gaps:19/149 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDISHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVA 65
            :.:||.||...|.:.||:||:|..|.|:.:|:.:.:|:||..|::.|:..::..:|.:|:|.:..
  Rat   104 LANISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDGDGQVDF 168

  Fly    66 PEFCNVILRKM-----RDTNHEDELREAFRIFDKDNNGYITTTELKNV-FTALGVKLSDDELEEM 124
            .||..::..|:     ||....:.:...|..||...   :|..|||:: :.|....|:..::|.:
  Rat   169 DEFMTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQR---VTLEELKHILYHAFRDHLTMKDIENI 230

  Fly   125 IREYDLDQDNHLNYEEFVN 143
            |          :|.||.:|
  Rat   231 I----------INEEESLN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 41/149 (28%)
EFh 12..72 CDD:238008 19/59 (32%)
EFh 84..146 CDD:238008 15/61 (25%)
Caln1XP_017453894.1 PTZ00184 106..>216 CDD:185504 33/112 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.