DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and TpnC41C

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001246139.1 Gene:TpnC41C / 35473 FlyBaseID:FBgn0013348 Length:154 Species:Drosophila melanogaster


Alignment Length:148 Identity:51/148 - (34%)
Similarity:88/148 - (59%) Gaps:3/148 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EDISHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAP 66
            ::::.|:..|:.:.|...|.:..|.|.:..:..::..||.|.:||.:..:|.|||.:|:|.|...
  Fly     3 DELTKEQTALLRNAFNAFDPEKNGYINTAMVGTILSMLGHQLDDATLADIIAEVDEDGSGQIEFE 67

  Fly    67 EFCNVILRKMRDTNHE---DELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREY 128
            ||..:..|.:.:.:.|   .||:||||::||:.||||||..|:.:...|..||::|:|:.||.|.
  Fly    68 EFTTLAARFLVEEDAEAMMAELKEAFRLYDKEGNGYITTGVLREILRELDDKLTNDDLDMMIEEI 132

  Fly   129 DLDQDNHLNYEEFVNMMT 146
            |.|....::::||:.:||
  Fly   133 DSDGSGTVDFDEFMEVMT 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 51/148 (34%)
EFh 12..72 CDD:238008 18/59 (31%)
EFh 84..146 CDD:238008 27/61 (44%)
TpnC41CNP_001246139.1 PTZ00184 1..150 CDD:185504 49/146 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.