DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and TpnC25D

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001285619.1 Gene:TpnC25D / 33752 FlyBaseID:FBgn0031692 Length:149 Species:Drosophila melanogaster


Alignment Length:148 Identity:48/148 - (32%)
Similarity:88/148 - (59%) Gaps:5/148 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDISHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVA 65
            |||  .|:..::...|::.|....|.|.:..:..::.::|:..:|:|:|::|::.|.|..|.:..
  Fly     1 MED--DEKMDIMRKAFQMFDTQKTGFIETLRLKTILNSMGQMFDDSELQALIDDNDPEDTGKVNF 63

  Fly    66 PEFCNVILRKMRDTNHE---DELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIRE 127
            ..||::....:.:.:.|   .||:||||::|::.||||||:.||.:..||..|||..:|:.:|.|
  Fly    64 DGFCSIAAHFLEEEDAEAIQKELKEAFRLYDREGNGYITTSTLKEILAALDDKLSSSDLDGIIAE 128

  Fly   128 YDLDQDNHLNYEEFVNMM 145
            .|.|....::::||:.||
  Fly   129 IDTDGSGTVDFDEFMEMM 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 48/148 (32%)
EFh 12..72 CDD:238008 14/59 (24%)
EFh 84..146 CDD:238008 29/62 (47%)
TpnC25DNP_001285619.1 PTZ00184 4..146 CDD:185504 43/141 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.