DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and zgc:153867

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_017209013.1 Gene:zgc:153867 / 337226 ZFINID:ZDB-GENE-030131-9170 Length:209 Species:Danio rerio


Alignment Length:147 Identity:45/147 - (30%)
Similarity:84/147 - (57%) Gaps:5/147 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DISHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMI-NEVDSEGNGSIV-A 65
            |.|.::.:...:.|.:.|:..:|.||..:...|:||||:.|.:|||..:: |....|.|..:: .
Zfish    61 DFSEDQILEFKEAFLLFDRTGDGKITYNQCGDVMRALGQNPVNAEVLKVLGNPKAEEMNHKLLDF 125

  Fly    66 PEFCNVI--LRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREY 128
            .:|..::  :.|.:|....::..|..|:|||:.||.:...||::|.|.||.|::::|:|.::..:
Zfish   126 EQFLPMLQAIAKNKDQGTFEDFVEGLRVFDKEGNGTVMGAELRHVLTTLGEKMTEEEVETLLAGH 190

  Fly   129 DLDQDNHLNYEEFVNMM 145
            : |.:..:||||.|.|:
Zfish   191 E-DANGCINYEELVRMV 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 45/147 (31%)
EFh 12..72 CDD:238008 18/61 (30%)
EFh 84..146 CDD:238008 23/62 (37%)
zgc:153867XP_017209013.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.