DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and calm2a

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_956290.1 Gene:calm2a / 336121 ZFINID:ZDB-GENE-030804-3 Length:149 Species:Danio rerio


Alignment Length:147 Identity:78/147 - (53%)
Similarity:112/147 - (76%) Gaps:0/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EDISHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAP 66
            :.::.|:.....:.|.:.|||.:|.||:||:..|:|:||:.|.:||:|.||||||::|||:|..|
Zfish     3 DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 67

  Fly    67 EFCNVILRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLD 131
            ||..::.|||:||:.|:|:|||||:||||.||||:..||::|.|.||.||:|:|::|||||.|:|
Zfish    68 EFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADID 132

  Fly   132 QDNHLNYEEFVNMMTMR 148
            .|..:||||||.|||.:
Zfish   133 GDGQVNYEEFVQMMTAK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 78/145 (54%)
EFh 12..72 CDD:238008 30/59 (51%)
EFh 84..146 CDD:238008 39/61 (64%)
calm2aNP_956290.1 PTZ00184 1..149 CDD:185504 78/145 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BAEQ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D600030at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.