DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and CG31960

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_722942.1 Gene:CG31960 / 319047 FlyBaseID:FBgn0051960 Length:148 Species:Drosophila melanogaster


Alignment Length:148 Identity:110/148 - (74%)
Similarity:131/148 - (88%) Gaps:0/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDISHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVA 65
            |:::|.||:.|:.:.:.:|||||||||||||:.:||||||||||::|||||||||||:|||||..
  Fly     1 MDELSVEEQDLLKNIYSLLDKDNEGAITSKELGMVIRALGRQPNESEVQSMINEVDSDGNGSIAK 65

  Fly    66 PEFCNVILRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDL 130
            .||||||||||.|||.|:|||:|||:|||:|||||:||||:.||.|||.||.|||||||||||||
  Fly    66 EEFCNVILRKMHDTNKEEELRDAFRVFDKENNGYISTTELRAVFMALGEKLEDDELEEMIREYDL 130

  Fly   131 DQDNHLNYEEFVNMMTMR 148
            |||||:|:|||.||||.|
  Fly   131 DQDNHINFEEFTNMMTTR 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 109/146 (75%)
EFh 12..72 CDD:238008 43/59 (73%)
EFh 84..146 CDD:238008 49/61 (80%)
CG31960NP_722942.1 PTZ00184 2..148 CDD:185504 108/145 (74%)
EFh 12..72 CDD:238008 43/59 (73%)
EFh 84..146 CDD:238008 49/61 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443690
Domainoid 1 1.000 82 1.000 Domainoid score I1952
eggNOG 1 0.900 - - E33208_3BAEQ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53419
OrthoDB 1 1.010 - - D114177at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.