DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and RGD1559821

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_006249352.1 Gene:RGD1559821 / 304447 RGDID:1559821 Length:151 Species:Rattus norvegicus


Alignment Length:149 Identity:38/149 - (25%)
Similarity:78/149 - (52%) Gaps:5/149 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDISHEERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMI-NEVDSEGNGSIV 64
            |.|.:.::.....:.|::.|:...|.|...:...|:||||:.|.:.||..:: |....|.|..::
  Rat     1 MCDFTEDQTTEFKEAFQLFDRTGNGKILYSQCGDVMRALGQNPTNTEVLKVLGNPKSDEMNVEVL 65

  Fly    65 APEFCNVILR---KMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIR 126
            ..|....:|:   |.:|....::..|...:|||:.|..:...|::::...||..::::|:|.::.
  Rat    66 DFEHFLPMLQTVAKSKDQGTYEDYVEGLHVFDKEGNSAVLGAEIRHILVTLGENMTEEEVEMLVA 130

  Fly   127 EYDLDQDNHLNYEEFVNMM 145
            .:: |.::.:||||.|.|:
  Rat   131 GHE-DSNSCINYEELVRMV 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 38/149 (26%)
EFh 12..72 CDD:238008 16/60 (27%)
EFh 84..146 CDD:238008 17/62 (27%)
RGD1559821XP_006249352.1 PTZ00184 5..149 CDD:185504 36/145 (25%)
EFh 11..75 CDD:298682 16/63 (25%)
EFh 11..39 CDD:197492 6/27 (22%)
EFh 94..148 CDD:298682 15/54 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.