DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and Cabp1

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001297641.1 Gene:Cabp1 / 29867 MGIID:1352750 Length:350 Species:Mus musculus


Alignment Length:145 Identity:45/145 - (31%)
Similarity:81/145 - (55%) Gaps:5/145 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EERVLILDTFRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPEFCNV 71
            ||...:.:.||..|||.:|.|..:::...:|.:|..|.:.|:..:..:::....|.:...:|..:
Mouse   205 EEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVEL 269

  Fly    72 ----ILRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVF-TALGVKLSDDELEEMIREYDLD 131
                :|.:..|.....|||:|||.||.:.:|.|:|:||:... ..||.::...::||:||:.||:
Mouse   270 MGPKLLAETADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLN 334

  Fly   132 QDNHLNYEEFVNMMT 146
            .|..:::||||.||:
Mouse   335 GDGRVDFEEFVRMMS 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 45/145 (31%)
EFh 12..72 CDD:238008 13/63 (21%)
EFh 84..146 CDD:238008 27/62 (44%)
Cabp1NP_001297641.1 PTZ00184 201..348 CDD:185504 43/142 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.