DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment azot and Cabp2

DIOPT Version :9

Sequence 1:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_006531826.1 Gene:Cabp2 / 29866 MGIID:1352749 Length:324 Species:Mus musculus


Alignment Length:137 Identity:46/137 - (33%)
Similarity:77/137 - (56%) Gaps:10/137 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FRILDKDNEGAITSKEMAVVIRALGRQPNDAEV-----QSMINEVDSEGNGSIVAPEFCNVILRK 75
            |:..|:|.:|.|..:|:...:|.||..|.:.|:     |....:||.|....::.|:    :|.:
Mouse   191 FQEFDRDRDGYIGYRELGACMRTLGYMPTEMELIEISQQISGGKVDFEDFVELMGPK----LLAE 251

  Fly    76 MRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTA-LGVKLSDDELEEMIREYDLDQDNHLNYE 139
            ..|.....|||:|||.||.:.:|.|:..||:....| ||.:||..|::|::::.||:.|..:::|
Mouse   252 TADMIGVRELRDAFREFDTNGDGCISVGELRAALKALLGERLSQREVDEILQDIDLNGDGLVDFE 316

  Fly   140 EFVNMMT 146
            |||.||:
Mouse   317 EFVRMMS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
azotNP_610336.1 PTZ00184 1..148 CDD:185504 46/137 (34%)
EFh 12..72 CDD:238008 16/60 (27%)
EFh 84..146 CDD:238008 27/62 (44%)
Cabp2XP_006531826.1 FRQ1 166..324 CDD:227455 46/137 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.